SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE23634 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE23634
Domain Number 1 Region: 982-1422
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.94e-142
Family Reverse transcriptase 0.0000208
Further Details:      
 
Domain Number 2 Region: 647-679
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000284
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 
Weak hits

Sequence:  31234.CRE23634
Domain Number - Region: 721-827
Classification Level Classification E-value
Superfamily Acid proteases 0.000173
Family Retroviral protease (retropepsin) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE23634
Sequence length 1547
Comment (Caenorhabditis remanei)
Sequence
GKLYHHREKMADIEEEEANRVAEEGRIRQEEANRLAEEERIRRENELLAEEPMDEGDEDK
RVQEVRLAEIEKVINETCIDIKNQTKFSTKQCRVLLSPLIGKILEVEEQFRGKKKESEFW
ENTNVKLNKTVLSLQDELERKSPPQPSTPLEEPPTTSVLSGQSIQGNEERWKLVSLLEVN
EIHNEEALNELFGKIEQLGNELSTHKELLQKAREQSDRSKEEYFQAKQQIVMLQLKLKAE
EEKSEKLKKENDTVAANNQSNNLTRYGEQRQSITEKNNNIVQTTGRHSMFATSTPQHGMH
RQGEANGKVGESRENARFYNADTSEIIDTITRQESRDSGGNWNQKIVEQDAQRSMIVHDG
HEMPNMNMQWRMTQALPDPPVFSAGKNSVNAETFERAFYMKYRFFDIEAQKSFLETRFLA
GNALTVYKGLPESDKYSVSRILDAIKRRLSQSEPEESRRAKSKFQGLKLQKEQSIQSFCL
QMDEIVRVGYKGVPEHQISSMKTTKLLDEMKEHSIFDVSLQILGSQLRKCPEMEQYELCR
EEATRFDEEWRSGKAKLNEKKVNRQQSNQNFSNQQSNYSNQNTSYSRNKQTVGNDETSQN
WRERSQGKFVPTNNAGGNNVVNKSVGFSECSECRLTGCHDPKCSRAPGSSTPRKSNPVVC
FRCNEQGHIAPNCPQKNAQQLNSQGDMAKVQTLDKKECLEMPEAEKSKQNKNSRTPVRIE
QGRIGSAEVNFVIDSGACISVISENTWEEVVEKNGGKEWEKEAILKNPEKIDVYAANNTP
MNLLYQVKVETSLHSRTRDLKFYVTDIDRDTVILGIDQFELLGIQMSFQKKPRDIRMVRQ
VKIPPGSEKIVEVSVEGTIRKDKSLCLITPMVSCLAPAIYQIRKSGKARVQMSNLGKKSI
FLKKGELVASGEVEGFDVIEENEENMKLLEEFVERSKLLEQDMETINLIETNVNSGERWD
ILCEQLKKTCAKCEEEEDVWKVIKDYQHIFATDDTELGRTNVVECEIELTEGAQPVRQKA
RPIPLAIRGEIRKMIQKMLSQRVIRESKSPWASPVVLVKKKDGSVRMCIDYRKVNLLIKY
NAHPLPNIETTLLSLAGKKVFTTFDLLAGYWQLPLKEESKEITAFAIGSELFEWNVLPFG
LATSPAIFQAAMECVVGDLLGTCVFVYVDDLLIASENMKEHAIHVQTILERIEKSGMKLK
ASKCWIAREEVDYLGHMITPEGVKTEEAKVDKMKKFARPEDVKQLQSFLGLVGYYRNFIM
SYSKIAYPLNFLTSKKNAWVWGTEQENAFVQLKSSVCSAPVLRQPDPETAISGARPYLIY
TDASRQGVGAVLAQEANDGEQHPIAFASKSLTSAETRYHITDLEALAMMFALRRFRTIIY
GSQVIVFTDHKPLISLMRGSRLADRLMRWSIELIEFNPKIVYVKGKANVVADALSRGGCP
LIDPDDMETGDMPNIIGEVKMIKEGNKFDTSEWLGKLRKEEGWSEVIEKLENGEKTGSVK
FPGIRKGIWLDNYMIIGRSLRNTEDENYFFFFFYLFIYLKDFHHLYK
Download sequence
Identical sequences 31234.CRE23634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]