SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE23978 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE23978
Domain Number 1 Region: 810-1127
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.96e-53
Family Tandem AAA-ATPase domain 0.00024
Further Details:      
 
Domain Number 2 Region: 584-631
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000199
Family Retrovirus zinc finger-like domains 0.0013
Further Details:      
 
Domain Number 3 Region: 634-680
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000143
Family Retrovirus zinc finger-like domains 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE23978
Sequence length 1164
Comment (Caenorhabditis remanei)
Sequence
MSFSDDGWGIQESEVKVEIVPTKVIEQPPVVENPRVNTIGRQVPKGEVAERIHPKMETIL
EQLPKTESSEVFRGSPPPVFLNDEVPAKRETEKPSNNDIDACSDDGWGSPTKKEEFRLPT
VSKSTASKLPPARALQPIVPAPIDDTLDIESPRELSPAPPTERGVLLTTTSSRKGSDFNK
PNSNFGKSFGTQESVRSENDNMIPKGPSPVVQGDGRTQKSFGSQKTNEEGVQKSSLLVQD
KISKDIPPVGTVGSFGSQAHADKVPQREDLISDRLKPTGFGGSFGAPKAATFGSIKPSGF
GSGNPTSFGSIKPSGFGGSESTKKATGKIENESQDKSTGFGNSDDSKHERTDTSAEKTTF
GFGEVRRSFGQAKAQEPEVSEVEPNTETKRSFGFGKPTDFDSGSNQSKLSFGSTSQKPTS
FGTQSFGFGKSADQGFKTSGATSSLSKQSAFDIGKENTGNVGEFKTESINNGFGLQANND
FGKTTRPDFGTKPSISFGGKKSELSNTGFGVSGNTGFGGKSRSGFGETSNNGFGEKSNNG
FGTSSEFTKASFGSLGQLEKDGGFGEDNTNSKGGGWGNESRHEDAERPRGCHNCGEEGHF
SRDCDKPKQPRFPCRNCNVVGHFAKDCPEPRVPYGPCRNCQEEGHFSKDCTKERVRTEPT
EPCRRCNEEGHWSSECPSRPRDLQGNILVSYDVVFTPEDEMFGDAVNNDDKINFDQKVFA
SMGEIDVPDMASFDAFKVLPQDVHDNLKRMKMNRPTPIQRASFFPILHGFDVVACAHTGS
GKTLAFLIPLVINLLEDRSHHHDVTDEKPSPRLLVVAPTRELASQTFNTARQLTYQTGLK
CGIAYGGYSRSANLQLLRSFDQLGILVATMGRLHDFLESDEISLSKMKFVVLDEADRMVD
SADFGEEVSKIIGSPETRTQQTILFRYHLLWLARKYCIYFSASFSENLQAEDLPKFVKEG
YTMLQVDKFGTANEKIDQRILPVPRTEKRSELYKLLGFDENTMSVLPDAPIEKEKTLIFV
NSVKFCDTLASNIANCGVPCTSMHSHQNQEQRDRTLDDFRRGKYKCMVASNVCARGLNIA
GLDHVINYDMPDKKGFDEYVNRIGRTARAGFTGVSTAFIDEESDREIIPSLINVMTEANK
KVPEWLVNINEGAGNADEGQDEQW
Download sequence
Identical sequences E3MGA3
31234.CRE23978 XP_003104831.1.11157 CRE23978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]