SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE24081 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE24081
Domain Number 1 Region: 544-699
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.41e-40
Family Retroviral integrase, catalytic domain 0.0044
Further Details:      
 
Domain Number 2 Region: 352-442
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000356
Family Retroviral protease (retropepsin) 0.016
Further Details:      
 
Domain Number 3 Region: 283-325
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000785
Family Retrovirus zinc finger-like domains 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE24081
Sequence length 901
Comment (Caenorhabditis remanei)
Sequence
MSDAEMNRKFIEMMELMQKQMAEQAKKHEETIAVLTKAVAEKSQIDSSLGTSSGLTVSQS
QLMNDIGGRISVFRFDLETEKTFSKWYARYSTAFTEEGKGLDDKNRVALLVSKLSEEVYE
QYSRRICPKLHHEVDFKDTVDILKEMFDIKKSLFSHRFACINIARDGDSPVEYTNKVNSL
CELAMLKDIDPDGWKVFFWLRGLDPAQDTKARAYFLKYVEKKTELGEKVNINELCTEWQK
IQSQTSAVSEMEKSDTAVRAVYAKKPSNQDQSGDKNTSEYDYSEGGKCWNCGKRGHRKPD
CPKPLTTCFDCQKKGDMSSFCRSRKDSSSRKTQHVAIVGGASSEDAEVNSVRQYVSVDVN
SESVEFQLDTGSDITLIGREDWTRIGKPDLEKCTSKVKSASGNELKILGRALVEFRLKES
VGTGYVYVREHGNLLGLDWIGKSEEMSYHMGMMVNELTHSNTDGIHGGLNGKFPEVFKKG
LKRCVKKKAVLKVKENATPVVRSKCPSVNGASRVVEKVVSSCTISLGGKIPRKIPLQPWK
TPERVWQRVHIEYAGPENGQYYLVAVDAKSKWAEVKIVKSISAVSTVGTLKDMFSQHGYP
ETLVSDNGTQFVSKEFATMCQEAGIEHVRSPAFHPQSNGQAERFVDTLKRGLKKLKGEGS
VNTEILSQFLLHYRSTPSNALGGLTPAEVHLGRRLRTRLSLMMPQLNKTVDSEQVAMKEQ
FDKHHGVKARSYRKGDSVFVKVFEKNTWSWKPGKVNQRQGRVVYVIGLNDGRERVVHANQ
MKMRLEESTQEQSKEHEWATTMFDVFELPTVWSARKSTDEAKRDMTPTPVMDSPQRVHQG
QGTSSSPAQQVQSRASTQQSSSQSTTTTAVQGQRLAPSPVQPRRTTRVRKNVVKYDPSDH
R
Download sequence
Identical sequences E3MVQ1
31234.CRE24081 XP_003099782.1.11157 CRE24081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]