SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE24348 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE24348
Domain Number 1 Region: 300-399
Classification Level Classification E-value
Superfamily Acid proteases 0.000019
Family Retroviral protease (retropepsin) 0.017
Further Details:      
 
Weak hits

Sequence:  31234.CRE24348
Domain Number - Region: 240-274
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000293
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 
Domain Number - Region: 54-165
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0942
Family IMD domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE24348
Sequence length 686
Comment (Caenorhabditis remanei)
Sequence
MSFSTERTKKRSSSVTSSEKSWAVQMNEVRLKERRKLVRGFTDFLESSGRMESDMYEALK
AACKGNERQSEVLVEPVKKYCQELRERFEELGGERWPLEIIGVMRENGVETVEELRELCE
KGVEMVPGGIVENANKAQDELALLQDAWNEERETLFRELNKLKEEKRLAEEAVSKYKKTL
KEEREASSELRGLLRKQENEPKKAGQARDTKEVPVPSRLEVVRKWSPRDSDDEFSMHGRR
GDRKTVGERRDSGAKMKCFTCGGIGHGSWQCVSKRVDKVQIQEGTVRNAGVETVEMVEML
GQRRRVVIDSGAVVSVISTTAYERLKAGCRDWEKEVEVFGKPTFTVLNASNSKMRVRGQI
KIPMVVRGRKVRVVFQLVDNWVERILIGTNAFESIGVELKWKDPYGLVNAEENSAEVQFS
GGEKKLERPGEKLRKVPTEVSEIQCKSVAVRGERGRRASTGDVGEVFKSEGEEKERKKVK
IRASVVVIGPRLEARGPGVLEYRNKTITGWTQKFDWGEVKEAVVLVEYTDKEDENSKRVE
FVKSVAKEVEKVWMMPRSLQCELGDVDKVAKQWKEWLKTSANVEVVDPLMPVGNHKTPLI
LEKWHRKSLDGLQKYLHNALPSHSVRSQWEKNTDRRPQSGVKKDLGKGCPIAERRGKWLR
RSSTFSKPHGITEVKGNEYSRGNRKT
Download sequence
Identical sequences E3NTU4
XP_003088177.1.11157 CRE24348 31234.CRE24348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]