SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE24570 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE24570
Domain Number 1 Region: 516-616
Classification Level Classification E-value
Superfamily Acid proteases 0.00000201
Family Retroviral protease (retropepsin) 0.03
Further Details:      
 
Domain Number 2 Region: 467-493
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000523
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE24570
Sequence length 844
Comment (Caenorhabditis remanei)
Sequence
MSDKTSSKQSTSKVDDDRMIVVETQMSVKERRKKVKKFTKLIASIVKVEDETRLQLGELT
AKCSEQEADAILEPMRIFHRELLEKFEEIGGDEWPRSVIRVMREFKLESVEELREACAKA
AEGEEAEWSVGKVNLELQQVQYEMKVLTECWNEEREMLGEQIRKVQKEKEVAEIQVSKLE
KALKQLRNTLERQERKPNGLWDEVQGSRSWCERVENWDIERNDERSRKKGGEDAFSRKTL
SHSGSSEVNDMMQCMNRMLKSSALPEPKTFDGTGEFKEFKRAFLLKYNHVTENDYELVAI
LEEKFLKGAAKSLFKTLPKRFERSIQSLFEEFEQKLRKRQGDSKIEALNEFEGLEKRSDQ
KMWEYLVEVEKWSRKAFPEVKQETLSQMRTTKLMKAVRGDETLHKMLIMKRFELSLEEQY
DHLKDIVLQQENEQRRGNSQKSGNSEGWKERPKAENDGGKDVAEKESGENRYWREQKCFS
CGGVGHLARQCSPKPVQSVEVRGKGEGVGIVAVETVMMLGQERKMVIDSGAAVSVMSTEA
WNGLKKGCRNWMEVVKMLGKPSFEVIDTSKKKMRIIQQIEVPIQVRDRKAEVVFQLVEND
AEIMLLGTNAFESIGVSVEWKQERTDVQQKKGKRDATSSEEKKVFTVGNLGIRVENTKPS
GKTAERSKEIAVDTVTEEKKEGMKPKKTVIRVSKILITPRIGVKGKSIFEYRKSALNTWK
DKFDFANVESIVFLLELTEDEETNQRLGDLVRKLAEEVKEITIIPYKMDCAKSGLVESWK
RSWITAGHVKWSDSAASAGEKFKTWEQLLEFLEARTTENVVVAQLRKESVTSEPRIKENK
WSHQ
Download sequence
Identical sequences E3MV76
XP_003099935.1.11157 CRE24570 31234.CRE24570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]