SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE25728 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE25728
Domain Number 1 Region: 194-235
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000785
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 
Weak hits

Sequence:  31234.CRE25728
Domain Number - Region: 453-469
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00174
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE25728
Sequence length 568
Comment (Caenorhabditis remanei)
Sequence
MIPEIVFNSISPETEVSANTGRSTTSSKHVYTANKQKNSRQFKRFDTTSPFKHRDVRDLL
KSAKRRLKRITDDQVRKHQWSETDVGLAPGDVGRRKTSENLKIQSFSGFSDAKISELARQ
SYSGNTTSKKEVAPEKFLIDLNPDSKSLVWLLDGCITSAGQPAPNAQLPTEPIASPTNIV
IDYRDRVNQRDLSRNNRRRNHNGGGNEWSERKCYYCQKTGHYLRGCRQKREDRENGIITQ
RSNRDWNPRHNHQIDVNAVFRDDEVKALRDAIQARDEQIEELSKQLDRISQGSHYSTSES
STSEASHLRSTYDPPGESSADSLFHKALKLTMQSYHEYRKDPEYQNEVSLERLLERLNQA
IKSLAIREAPSTTDQTPDTAREGEACLVPNQQPPEPTQLSTQLAASLANTATDHKDQDDC
RDHRSERQGRDDDYGGRSSENDSQVSRREILLTFTGKCHYCGKVGHMARSHKLKQQSVAN
QQKSKDPVSNHQVIQVDAEEEASCLREMILWQDLRIHELKEWNDRLRRDNSSSTSGNQTS
QADPPSAMALWTIFGQKNKFPRSKFNLV
Download sequence
Identical sequences E3MLB6
CRE25728 31234.CRE25728 XP_003103104.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]