SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE25793 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE25793
Domain Number 1 Region: 163-200
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000436
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE25793
Sequence length 394
Comment (Caenorhabditis remanei)
Sequence
MSETSSEAMENAAAPVKLMDRNAYYRSPRSANPWPSPMSHNTGTIGNTGGSSEPVKKYGG
GFGVAKVDGQSTTARAGGATETISNFDDFSGFTFRKDTSARSGFGGSFGGTALPRIMSVD
LNMTKDRSVPPSPPDVTLLANVPRRGGFGVAGSPRSDGISPTKRPRSGRRTGRRGRSGPG
HCFHCQEHGHISRLCPKKAAETDEFDESEAVQLLDNDSTKKNASPAGRDGLYQNAKLENQ
KARESYYGGYNYGNNKSSVPMKSAVVGTGRSVGESSVPPSEVDKFSEQLDNALNLHTKTI
TLQPRGSSASTVATKAPSARITPNKAPVAPVTSSGVGIRDETKETTIDTLTIETRRTVKR
EGDIHFEETTTICFPRVLPSNVRIINAQIMPVSQ
Download sequence
Identical sequences E3N5N8
CRE25793 XP_003096306.1.11157 31234.CRE25793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]