SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE25866 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE25866
Domain Number 1 Region: 453-491
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000785
Family Retrovirus zinc finger-like domains 0.0023
Further Details:      
 
Weak hits

Sequence:  31234.CRE25866
Domain Number - Region: 405-442
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000314
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 
Domain Number - Region: 819-904
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.000593
Family Reverse transcriptase 0.01
Further Details:      
 
Domain Number - Region: 570-616
Classification Level Classification E-value
Superfamily Acid proteases 0.0309
Family Retroviral protease (retropepsin) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE25866
Sequence length 908
Comment (Caenorhabditis remanei)
Sequence
MVHRNRVEQSGRIRVANQANQDYLQSQISAVIFFLTNIHWCSAIYFYLPTLLFYSSLLFY
EMSVLRYVQGVVTKSCGTLKTYIEECEVNLVDWGHLDSNDEAIRTELAKTIHILEAKIST
VNVAMNNFLIKAAEIDEKNSAEQEKVEEKISQVIEITDIANSVMARAQAEMKRMSQKAEK
KEEKKMGETIFAHRNNQMAATMPKVPKFNGNRSDYENFWLLFETSLKVNGVENDLLKFNF
LLNSLEGEPKELMRQFRLSEENYQKAVNLLQKKYYDKKRIVTELTRQLRSIRAKSESTSD
QRKLLDTITIIVSQLNENRGQIDAEMTKDIIVEKFDMRIREKIEDMQLDAQDDWTIEELL
EKMDSVITREEKLNIKLDRSEKSEKSSKETSKVRTSNNYATNNSNNGKSKSRENGRDTDR
PKTCVYCKADGHWGFECVKVSTAKERKDILKSEERCIQCTMKGHNLDNCRRKRKCYHCKE
IGHHSSICTSKPKDSSDDSSSRRRETADKNKQKTKTTAVAQIEEDETTSERKEEELNSHV
SKVEKKAKTRAFIPTLRTRAYNPQNGQWDEVSMMLDCGADQTYVTASLAKKWNLPMYDKE
QFWLRTFDSEEAALKTYGRTNIKILAGAKTMEMDVLISANLAGKVKKARLTEEDWMYVNE
KQLQINEDCKEDISFPDVILGCDYLGDIETGRRIRLPSGLDVIGTLMGYTTTGKMTHPAQ
EKENKEEKFIMVAIEDSEKTGQDIEESQKRDTAMKTQEEFTGSAQEEKARIDKEVWEFFK
RTVVKKNGRYYARIPFKKGHPVLPDNFSIALKRLLSVHRNSSKEVLKMIDDVFKDQLQKG
IIEEVDPKKHTQFLVHYNPHQPVITPQKTTTKCRVVIDGGSHYKGKPSLNDVIHQGPVIL
PDLVDMLI
Download sequence
Identical sequences E3NDT2
31234.CRE25866 XP_003093446.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]