SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE26064 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE26064
Domain Number - Region: 256-282
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00117
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE26064
Sequence length 988
Comment (Caenorhabditis remanei)
Sequence
MGVPAFFRWLTKKYPATVVNANEDRQRDADGKRVPVDCTQPNPNFQEFDNLYLDMNGIIH
PCTHPEDRPPPKNEDEMFALIFEYIDRIYSIVRPRRLLYMAIDGVAPRAKMNQQRSRRFR
ASKEMAEKAASIEEQRNRLMAEGIAVPPPKKEEAHFDSNCITPGTPFMARLADALRYYIH
DRVTNDASWANIEIILSDANVPGEGEHKIMDYIRKQRGNPAHDPNTVHCLCGADADLIML
GIATHEANFNIIREEFVPNQPRACELCGQYGHELKECRGAENDTDLGDDYCKPEQREKNF
IFLRIPVLREYLEKEMAMPNLPFKFDLERALDDWVFLCFFVGNDFLPHLPSLEIREGAID
RLIKLYKEMVYEMRGYLTKDGIPELDRVEMIMKGLGKVEDEIFKRRQQDEERFKENQKNK
KARMDQYGRGRGRGRGRGRGQPAYVPTFGILAPMSAPMHHSGESTRQMASDARQTAMQFN
TTNDANAQAAANLKALLNVKGEESPADVAARESRKRKAEEPLVVPEEDEEPKDDIRLFES
GWKDRYYRAKFDVGSDDVDFRHRVAWAYVEGLCWVLRYYYQGCSSWDWYFPYHYAPFASD
FETVGEFKPDFTKPTKPFNPLEQLMSVFPAASKQHLPVEWQKLMIEDDSPIIDLYPADFR
IDLNGKKYAWQGVALLPFVDEQRLLATLKSVYPTLTDEEKQRNTRGPNRIFIGRNHKSFA
FFQQVAESKSTDMVDLDPSLLNGVSGKIASDSTATAPGLPFVSPVNHEDCQDLPTNCGIC
VLYEDPEYPENYVFPAVRLDGVKEPEKTLKPEDWNERREGRFNPTIGFNRNAPRGGLDPS
GQRHINHHVRGAMSDRQGGDNYRGGYRGYQGGYDDRRGGRGGGGGGYRGGYNDQRPDYGR
NYGGREGNVEEMFKNDDNFSGGGPQRHHDNYQGGHGGGGGGGGYNQQPYNQDQRRGGYQG
GRGGGPPGYQRPPYRGARGGYQGNSSWR
Download sequence
Identical sequences E3LRH7
31234.CRE26064 CRE26064 XP_003113732.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]