SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE26595 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE26595
Domain Number 1 Region: 425-466
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000192
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE26595
Sequence length 694
Comment (Caenorhabditis remanei)
Sequence
MAPSGRATPTPDSHGETSREDFYGSVRALKGRVAAIEEEASDGDKERAFPTMLKDQAGEN
LETILNEDRGRDHNADKVGSMNNPMRNRNHLVSGNAQKSSDSVTDDTKSTIQHFLLMKKE
TIENLDVACKAANKLAAEQRINMQLVQSQVDRALFVTEKLNHLEEELSTMPVDLDRKVSD
RVFRNREVIGVGSGDDHRVIPPTAATTTRTRSLSPNSGTNTQHPYTPVVVRHQVAPLLTA
SHNNDLLQDLESEAESQEDVNRTFLTGLKKEARDEAESILAENPDATSDDNVQGLKEMVV
NTNHRQRNKAPLPSSKQVTGESAESFFHRISELARQSYSDNTTSQKEVALEKFLIDLNPD
SKSLVWLRTQATPEEAHSDAVSVDGCITSAGQPAPNAQLPAELIASPTNIVIEYSDRVNQ
RDLSRNNRRRNHNGGGNEWSERKCYYCQKAGHYLRGCRQKREDRENGIITQRSDRDWNPR
HNHQVDVNAVFRDDEVKALRDAIQARDEQIEELSKQLDRISQGSHYSTSESSTSEASHLR
STYDPPGESSADSLFHKALKLTMQSYHEYRKDPEYQNEVTLERFLERLNQAIKSLAIREA
PSTTDQTPDTAREGEARLVPNQQPPEPTQLSTQLAASLANTATDHKDQDDCRDHRSERQG
RDDDYGGRSSENDSQCSELMNLIFRLFIGGFHLF
Download sequence
Identical sequences E3MKR9
31234.CRE26595 XP_003103248.1.11157 CRE26595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]