SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE26648 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE26648
Domain Number - Region: 682-696
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00481
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE26648
Sequence length 795
Comment (Caenorhabditis remanei)
Sequence
MVRKVDTDIARLERTSNSEKEGGVAAGVATSEVGTWDDHRVIPPTNACGAGEASTVIHTQ
PKDASGVNPSISQNPTKTGGMSGVGSDANLIVNQLKEIGEIRDLKSLSDTDGTWKHQLLG
YTAKPVKETEEDNGKDSVPRVLTETAREDCNVSASANKDRIATIDEKTSEDDKNRAFPTG
RKNLATTWDAVETIQAEQPSNLVSRTGRMNRASLEAGRASQLVDSPSTKTKCLERKVSET
CLCSGVVDMVGKWDDHRVISPTTPTSPRARSLSSNRGLRPQILHTPVVVRQQGVSRDELA
ADLDLSQRLIDASEGIMENSHPPMANNLTPIRNGSPQSEEEKDESMPHANLDITVRYEVY
DSTPNERNEESPNPEDEQAAVTASGGTTSPGNTPPLRPSNGNIPNIQEAVASEANDEDKD
EANQVNQGRAENNEEVGTLPHVMAPSFKSAASLPAREDINNSVRSFRDHLVTINPDASQE
DSRRAFLTVLKYRARRRAESMLIEKPKSTLNELIQGLKEMFECTSHVQRNKTHSRSSNEL
PGESSADSLFHGTIKLAKQSYHEYQKNPEYQKEDVTLEKFLEGLNQAIKSLVIREAQSPT
DQTRSTALEGEACLVPNEQPPELTQSPAQLAASLANTATYHRNQDDCRYHRSERQSRDDD
YRGRSSEIDSQVSRREILLTFTGKCHYCGKVGHMARSHKLKQRSVANQQKSKDPGSNHQA
FQVDAEEEAKCLREMILWQDLRIHELKEWNDRLRRDNSSSTSRDQTSQADPPSAMALWTI
FGQKNKFPRSKFNLV
Download sequence
Identical sequences E3ML21
XP_003103235.1.11157 31234.CRE26648 CRE26648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]