SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE26703 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE26703
Domain Number - Region: 311-346
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0102
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE26703
Sequence length 496
Comment (Caenorhabditis remanei)
Sequence
MSKYGKSPTSVSSSRDVYKDASKTTPADLPEPTPADTSSTQSEMSDNTSDNNSGDSDEEV
SIRIQNDYDTSPVVRAIQEKSTPPSAPSKRTSRCSASSGRKEEDKENVPTSFAKKRGAKA
TETRGTVPQIFPKIGRLSKPTPAVVQPQDWEVRSVVFKPMDTAFAYGSSSREYKELRETI
KFVKNKLETFKSADEVTPEWISSADQVVSKLSCMGKNIKELVLANNKTVDTLQRACDIIR
GLHGVVAGLVATHHQESWHKYMANVVGSADETCKLVRSLTAANGRIEGLLMATAPAITHA
IPYKLVNTKSENPRKRAAKRNRGCTLCNKRTHNTKSCRKYPTSVDKIRRANKLNICLQCL
KKFPKNDTGSVFCGLKRQNSETGGHRMPRNKPKTPRIKTLNIFSSTGSPSVESTPTSTDD
AAPQIYAEVVAGPAVPAGPESSPPPPMFIRHPDGTEEVNPEAYIRRGYGWDGAHRQQLAG
RLARGRIMALSRIQRS
Download sequence
Identical sequences E3ML26
31234.CRE26703 XP_003103233.1.11157 CRE26703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]