SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE26763 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE26763
Domain Number 1 Region: 61-93
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000523
Family Retrovirus zinc finger-like domains 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE26763
Sequence length 201
Comment (Caenorhabditis remanei)
Sequence
MKMHVKLSKPKTPQDALETALSVEGVMTIPKHTDVLSNPRVLAATAGKVTNRDNSLRESD
DVRRSSVSSQQCYYCQEEGHYAWQCPEKTRRHHHPGSSRAQVGCIHVNTKQRLERLTEQE
HEGNFRSECYTLQCRKGNAQVAEPRCNAEYEDFGASANTISASIPIEANDHACLALVDIT
FTLLAVLVASPVYVHKTSPRN
Download sequence
Identical sequences E3NDM9
XP_003093470.1.11157 CRE26763 31234.CRE26763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]