SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE26787 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE26787
Domain Number 1 Region: 629-655
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000663
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE26787
Sequence length 1096
Comment (Caenorhabditis remanei)
Sequence
MADINEDDATRRAEEEANRLAEEERIRLENELLEEEEPMEEGDEEKRVQEVRLEEIEKAI
NETCTDIKTRQNSARNSVEYCCRHSLNELERKSQQQPPTSLEEPTATSVFSGQSIQGNQE
RTKMVSLLEANEIHTEEELNKLFEKYEQLEYELSVKVEYLQRSQRQTDSFRSELCRLKVK
CDQQQQKLLAEEEKAKKMSEELKTKYSNLRANSSTRVGECNQQTGERKESTRYYNAETSE
IIETIPLQESLDSGRNWNQRIVEQNAQRNIIVHNEHEMSNMNAQWRMAQALPDPPVFSAG
KNSVNAETFERAFYMKYRFFDIEAQKSFLETRFLAGNALTVYKGLPEADKNSVSRILDAI
KRRLSQSEPEESRRAKSKFQALKLHKEQTVQDFCLIMDEVVRIGYKGVPEYQISSMKTTK
LLDEMREHTVFEVLLQILGSQLRNCPGEEQYELCRVEATLFDEEWRSGKKKVAQKERGMN
RQQSDQPANNLQRTGSTQNNAFVPQQYSRFNRYTPNSQSNSYQTNSGAESGNNQCTSTTG
QQQNFSTSPDVTNQYAQKTDQQNQGPKGYVYNEKSPECWKNSVHSSDSANNASSSALGFH
KCSECSLTGCHAPTCSRAPGSNTSKVKINSTIVCFRCDQQGHIASKCPTRNAVIQEVRVA
PEIQSTVEDQKFKMKSDTKCSSDKESERELIDHEMKTKDLCEGQSVTASVFKKDMVIDVD
RVPSKSINSIEFSVMSSDEMLRSGDTKDDGLQTSCTKHAHTKDNNVGVNREFTEANSQKN
RNCDEEQKSERDQRLCSISLTKNKKQSAQQKKVSDVISSFGDLKRDQNEQSVQKSIVKCD
SIQSYMFSEDRDGEKKRNTVDQKAVDNVMCQGPPLNSIEDSSSLNQNDNMDASEVTNIVK
INTSKSKFLNQKCLKKPGLQKTGDDTCGVDFPKKTKRRNKEETRPRTDPPVSSPETSEYV
YNSVFCFDSDLWLKDTSPGSLDSDKDEQLDSYQKWKRTVPKMFKSQVIPRPLKDPPVSTN
QSTCSDTKFAPVTDSPRPLKDPPDSWMEDVNMRRMQEEYRPRKDPPSPYCQHGHRNLLGC
LQSTKFLPTPMSTVSS
Download sequence
Identical sequences E3NDQ3
CRE26787 XP_003093468.1.11157 31234.CRE26787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]