SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE27064 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE27064
Domain Number 1 Region: 3-83
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000363
Family Canonical RBD 0.009
Further Details:      
 
Weak hits

Sequence:  31234.CRE27064
Domain Number - Region: 78-103
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.023
Family Retrovirus zinc finger-like domains 0.008
Further Details:      
 
Domain Number - Region: 182-243
Classification Level Classification E-value
Superfamily Cloroperoxidase 0.0811
Family Cloroperoxidase 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE27064
Sequence length 304
Comment (Caenorhabditis remanei)
Sequence
MPSKLFVGNLPDNVDSNKLKQVFQPFCKVTECDIVKNYAFVHIEEDDVDSIITRLTGYSI
EGKVVNIKKSTSKLRPTPGMPNRCFRCQSDDHRTPQCPQDPSNSQKADGFQTIKIDLTAG
PGGLKRPAVDPIVDVPKRAAFGTQAVVEPEIPRPMEPDLQALYQEYQLSRQRYVYYRDRL
LKEMEAKKHGSTAGFALSTTSAIPVPVASVPPGATQLSAAPVSYQPNVPPVIPAVNAPYA
AATNLRAPYAVQSAPYNSAMQSTVPYGSVNAAPQTSVMTTQQYLQQMHQQTGSPAPVPAP
NRMF
Download sequence
Identical sequences E3LQ18
CRE27064 31234.CRE27064 XP_003114362.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]