SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE27916 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE27916
Domain Number 1 Region: 485-920
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.22e-117
Family Reverse transcriptase 0.0000861
Further Details:      
 
Domain Number 2 Region: 1099-1236
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.33e-35
Family Retroviral integrase, catalytic domain 0.0089
Further Details:      
 
Domain Number 3 Region: 362-452
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000000675
Family Retroviral protease (retropepsin) 0.018
Further Details:      
 
Domain Number 4 Region: 292-330
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000044
Family Retrovirus zinc finger-like domains 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE27916
Sequence length 1259
Comment (Caenorhabditis remanei)
Sequence
MGEEKLAFAKELTETLRMFREQMVASAEIQQQQMADNRRLHEEIAARAAAGSETETLENM
TVQTPRARNNARLMGDLARRLPRFVFTLDEPDSFKKWFSRHELVIVEDGKDLSSREQVRL
LLGALDESAFHRYVDSQREAADVYDIPFKDTVEALGRVFGSHRSLMMKRQECLQITRASG
MFHDPLEYSNRISEAVLDSKLATMSTDDWSVFLFLRGLDGPGDAAAKAFLMQWAEQCERK
KEKVTLALIHDEWLRFLQLKQQTKTVAASSPKQPLSVNKVEKKPVRNTSNHKTETKGHGS
ESQSKKEFTCFKCGEQGHCAPQCPQNSGKKKTGKRWEKKGAKKTQSVRVDNLDGNQSKSV
KPSMWVNVGSQMLKFQLDTGSEITLISEKSWKAIGAPELEEVPHRIACANGTEMIVKGRV
LVSFELKGVQYSEYAYVRQEFTNLIGMSWLAHSPEVREALDVVVSTVTTAVAEKDSNQLR
MSLQTEFPKVFEDTLGLCTKEKAQVRTLPNVKPTFKKSRPVPYGSEKPVEAELKRLENMG
VIERISHSDWASPTVVVRKKDSGKVRICADFKSSGLNTALQDEYHPLPTSEDIFGKLKGK
IFSQIDLKDAYLQIELDPEAQKLAVINTHLGLFKYKRMPFGLKPAPAIFQKVVDKLTNGL
PGVASYLDDIIVSAETMHEHEHILKLLFARFEEYGLKVSLEKCAFAKSEIKFLGFIVNGN
GRKPDPQKTEVIRGMESPKNQKQLASFLGAICFYSRFVPKLSDLRGPLDRLMKQDVDWKW
TNIEQNAFDRLKNSVADATMLSHFKEDWKIVIAADASQYGIGGVLSHINPEGQEVPIAHF
ARSLTETEKRYSQIEKEGLALVYTVKKCHKFVFGRKFSLQTDHKPLLAIFGDNKDLPVHS
QNRLVRWAITLLSYNFDISYVSTAKFAKADWLSRMIQNYPRDENDVVIAEIRNEDDFEDE
FPKAELYPVTAEDIRAASETDPEVSTVMKLVRHDSWKPKPHSDVEKYWHRYKDRLKILQH
CLLLDDRVVVPRKLQNAVLSQLHEGHSGIIKMKQKARAFVFWRGLDREVERIVQHCSSCQ
EQAKMPIVAPLNPWPAPEKPWIRIHVDYAGPVDGNYLLVVVDGLSKYAEVKMTKSISAVS
TVDLMEEIFCVHGFPELIMSDNGSQFTSALFKSMCKNHGIQHTTTATYYPRSNGAAERMV
DTLKRGLTKLKGTGSITKQLLSRFLFYYRNMPHARLMAGHLRRSQNPCMRTTMSLLRPR
Download sequence
Identical sequences E3NKK3
31234.CRE27916 XP_003091069.1.11157 CRE27916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]