SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE27931 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE27931
Domain Number 1 Region: 256-300
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000628
Family Retrovirus zinc finger-like domains 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE27931
Sequence length 464
Comment (Caenorhabditis remanei)
Sequence
MTTKTTEGAGSGLVDSISRRIANFEYEPEEGQAFEDWYLRYGDTITGEGTDLSDEAKRRL
ILSKLNRRDYNYFANRILPDKTSEFKFEEIVNKLKECFPSTRSTFARRMEFLKIIDKGGD
LGEYTGRVKKAYADAKFNEMSSEQVQCLMWIKGLRNNGTVDIRARAMQIMETRPTTTLIQ
LEHEIMKLLEFREDAKNIGGCRTSEEVFAVRKMRTEKAKEQKRSSQRHLLRKEKQRENEG
SSADENDSDEEKPTRNHNQRSKKCHRCGGEHNAMNCWAKNKECFDCGRRGHISKKCREQQ
DDEKSDRSGHRVNYIVAKTPKRRRDIYKVNGIYVKESKPRKISTEVVKNGSMKRHVRRWP
DEKFEKIQKNREETGNKRCKSFVTRSPNPGRKEKVGAFERHDRWEKKNPKENSRMQHELK
VSFPETLGQHSQWNRGWKQQGSSTPSLPIPXXXKQFWMLRRYVL
Download sequence
Identical sequences E3NMQ3
CRE27931 XP_003090318.1.11157 31234.CRE27931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]