SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE27986 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE27986
Domain Number - Region: 312-346
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0068
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE27986
Sequence length 382
Comment (Caenorhabditis remanei)
Sequence
DPQSTHDAHQLCLSNTQNAGHSNDVSGANNTKSPETASPVIQSPSPARGSPIGTHSTQSA
DLNTIFNTLKPFSGENEQYSLFITRFNSLVHTNPSIDTITKQNILISLLEGDAKDLITSD
ELSEGAYEELRTNLEKVYNRKNDRRKQLIESYRNLPFHQSDYEQMDKDVMKHVCLTNSLQ
KCQVSINDPFLIDTFVDKLPIRIMRSFIKQTRNSTPSFLEASTLVQTLISENRALDDAEQ
RKKNRTQLTEICTAEVNKLSISAKSPRNNESRHKQSRPPKPSKWRSAPCTFCQQNHPTNT
CQIPAKEKRDSIMKQNLCLNCLRNDHLVSDCQSRFRCNTCNRKHHSVICQENEKLEKLDT
LVNCVNTNENLKTFFRNNGVDL
Download sequence
Identical sequences E3NT66
CRE27986 31234.CRE27986 XP_003088404.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]