SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE28057 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE28057
Domain Number 1 Region: 579-609,692-770
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.35e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE28057
Sequence length 867
Comment (Caenorhabditis remanei)
Sequence
MSLFFDLEFRFSDCDFYSLLPYGTNVIQNYTKSRQSDVPDQTKFDHTYRFNRAYLSHFGK
IAFHIKNIGKWKRKEWCRFAKGLMPITMWLPHYSWKSSLLFDFLEYPSTVPLDYCSFIPG
LAYGMLVGVPPSYGLITGIIGPFVYALFGTSKHASPGSFAIVSLMVGAVVESFGHSVSID
EVDSIPNITKEFCCRENKPKVSDSDAIAIATSVTLLAGLFQILFGLMNAGLLAVWLSDQL
VQGLISGAAVHVLTSQLKSMTGVTNVPPTSEPFQHMQFYVCFFSQIKNIEIPAVIISIVS
VSLLLISAYIIDPWLCKKIPVKFPMELILVIGMTLTVHFTRNTSYHFNVKTVGEVTSGIP
APFVPPMNNLFGMMGSAISIAIISFVIHISLCKLISKKLQYVVSSNQEWFALGLMHSTSS
FFGCFAGGSSLGRTMMQVKCGTKSQLSTIVSSFVLIIFVMGAAGTIEHLPKPVLASIVVV
AMKDLYIQIFTCSTLRDKNFVDYLIFATTFTSVIVLNVNFGLIIGVVFELLTVVLRSQWF
IFIWNSKNYSEIYSRADSALLGRIRGTNHFRRLGLYETTYDIPGIKVFRFDSPLYFANSE
LFVGRIHEACGLNPLIVRGEIAETDKKRKAKEKKKEKADAENQHSKENETSESSPTLLLQ
SLLVSELEVSAHQAKVLDEKQPQLDPDPAVNFETTQLTHIIIDCSAILYVDLMGKDVLID
VYNDYKTIDISVLFTNTQERVRQLFETTNFFDEVPRNRVYVSVADAVDQAELEQRRKNDA
NIVLMKAAPKPTVAPPIAKSVGQKSVPLGDNTLVKTQSSASLVTGVEFSVRDNTAKEGTI
QKKPRVPSKSNIHWDDLDKTQTDSSKR
Download sequence
Identical sequences E3LM34
31234.CRE28057 CRE28057 XP_003114748.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]