SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE28146 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE28146
Domain Number 1 Region: 366-589
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.3e-59
Family Tandem AAA-ATPase domain 0.00000627
Further Details:      
 
Domain Number 2 Region: 408-471,666-756
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.42e-41
Family Tandem AAA-ATPase domain 0.00063
Further Details:      
 
Domain Number 3 Region: 154-206
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000768
Family Retrovirus zinc finger-like domains 0.001
Further Details:      
 
Domain Number 4 Region: 266-312
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000244
Family Retrovirus zinc finger-like domains 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE28146
Sequence length 798
Comment (Caenorhabditis remanei)
Sequence
MSDGWDDNETTAQGLFNSLFIDYLKFFVIVKPSGGNSGGSGFGGKSAGFGSGNTGGGFGA
KSGGTGFGGGSGGGFGGNSGGGFGSNSGGSGFGGKSGGTGFGGGNSGGSGFGGGNSAGTG
FGGGNSSGFGGGGGSGFGGGNSGFGGESGGGGYSGERNNNCFNCQQPGHQSRDCPEPRKP
REGGAPRNCYNCNQPGHQSRDCPEERKPRENKAGGGGFGGGNAGFGGSGGFGGGNNGFGG
GFGGNDDGFGGGGGGFGGETGGFGGGGEERGPMKCFNCRGEGHRSSDCPEPQRGCFNCGE
QGHRSNECTNPPKPREGGEGEAPKATYVPVEDNMQDVFDMQKISEGLMFDKFFDADVQVT
SCGKSVKRAPCKTFAEAKLSETMQKNVERAGYTKTTPIQQYALPLIRDGNDIMACAQTGS
GKTAAFLLPIMSRLMDDNDLNTAGEGGCYPRCIILTPTRELADQIYNEGRKFAYQTMMEI
KPVYGGLAVSYNKSQIEKGSTIIVGTVGRIKHFCEEGTIKLDKIRFFVLDEADRMIDGMG
FGNDIETIVNYEGMPKKENRQTLMFSATFPDVVQNCASAFLRENYTMITIDKIGAANKCV
VQEFELCDRSEKKDKLLTLLGIDIDSYSTEKSGCGCLYQEDDCIRFSTGDGRYLGCYLVK
CSSSRNYTLFLQIHGAREQRERSEALRHFRNGTKPVLIATAVAERGLDIKGVDHVINYDM
PDNIDDYIHRIGRTGRVGNSGRATSFIQNDSPLIPELLKVLGDAEQIVPDWMLESAGGNY
GASSFGGHVPAQQEEEAW
Download sequence
Identical sequences E3LMK2
XP_003114920.1.11157 CRE28146 31234.CRE28146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]