SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE28214 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE28214
Domain Number 1 Region: 19-86
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.41e-16
Family Cold shock DNA-binding domain-like 0.00067
Further Details:      
 
Domain Number 2 Region: 110-154
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000121
Family Retrovirus zinc finger-like domains 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE28214
Sequence length 208
Comment (Caenorhabditis remanei)
Sequence
MIEAALENPVLVKSALSPTPRYFGSCKWFNVSKGYGFVIDDITREDLFVHQSNLNMQGFR
SLDEGERVSYYIQERSNGKGREAYAVSGEVEGQGLKGSRIHPLGRKKAVSLRCFRCGKFA
THKAKSCPNVKTDAKVCYTCGSEEHVSSICPERRRKHRPDQVAAEEAEEAARRAAEESSS
TSDEGSSGIKEEHHEHQVKNETSDDSEQ
Download sequence
Identical sequences E3LMX5
CRE28214 XP_003114651.1.11157 31234.CRE28214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]