SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE28691 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE28691
Domain Number 1 Region: 283-718
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.07e-121
Family Reverse transcriptase 0.0000947
Further Details:      
 
Domain Number 2 Region: 150-243
Classification Level Classification E-value
Superfamily Acid proteases 1.2e-16
Family Retroviral protease (retropepsin) 0.0085
Further Details:      
 
Domain Number 3 Region: 83-127
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000105
Family Retrovirus zinc finger-like domains 0.0032
Further Details:      
 
Weak hits

Sequence:  31234.CRE28691
Domain Number - Region: 892-971
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0138
Family Retroviral integrase, catalytic domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE28691
Sequence length 1059
Comment (Caenorhabditis remanei)
Sequence
MSDDQLCCLIWINGMKDSSYQDIRTRALQVLEQKPRITLLEMEAEVKRVLDIRADSKAVA
PSNQSPEVQAVQKKPQNQHNQNKTEKQPPSPCYRCGGNHWSKDCKYQTATCRTCNKPGHI
AKSCRSKPRDHPKVSHKVKTVFVGVAATHGSTRIYKSVTINGKPIKMLLDTGADVTLVNL
TDWKRLGRPKLEPPSIRVRAANNQVITVKGSFNCNFELNGVRATGTAHVTETNTLLGIDW
VAQDQTFWKLLHDAPTINSASTSSGSACSYLDGLRDGLKVDLSSEYPDVFQSGLGLCTKM
RAKLKLKPNAQPVFRKSRPVPYASLEALSNEIDRLEATGVLKSLDHSDWAAPVVAVTKKN
GSIRLCSDFSTGLNDAIEAHQHPLPTADDIFAKLNGGKFFSQIDLADAYLQIEVDDDSKK
LLVINTHKGLFHYNRLPFGVKAAPGIFQQVMDTMLAGLDGVSCYLDDIIVTGCSIEEHNQ
RVKKVIERIASFGFRMRLEKCSFLMPEIQFLGFVINEQGRKPDPQKIADIKAMPAPKNAI
EVRSFLGLIQFYGTFVRDLHRLRPPLDKLTNKDVEFKWDTECQHAFDQVKEMLQSDLLLT
HYNPKLPIIVAADASQYGIGATISHRFPDGKEKAIYHVSKALNKAQRNYSQIEKEAFGLV
TAVTKFHKFVHGRRFTLRTDHKPLLSIFGEKKGVPIYTANRLQRWATILMNYNFSIEYIN
TKNFGQVDALSRLISDQMQQREETEEVVIAHIEGDIICSLDRVCDQLPVTVDIIRSETHR
DKLLMKVMECIRSGKWPVLDKAAPIWLFQQRQTELSIVQECVMIGERIVLPTSLKTKVLL
MLHRGHPGIVRMKKLARSYVYWPAMDKDIENLVKCCDPCAGAAKNPVKDVLHSWPCSTKP
WNRVHADYCGPTTRYLLSRNCRFLLEMAGGLRHEVNHHKRTFHLSQYSQSLASSILEILV
TDNGSQFISKQRDICSYAPTSAAFSINGRESIYYPLLFGFSLPLKTALQKLRGEGNLLSL
PALHNYAPGAPPCHTTHTIGTTCRELPHLATSNRTTHMS
Download sequence
Identical sequences E3MK21
CRE28691 31234.CRE28691 XP_003103520.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]