SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE28740 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE28740
Domain Number 1 Region: 339-461
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.14e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000199
Further Details:      
 
Domain Number 2 Region: 461-507
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000196
Family Retrovirus zinc finger-like domains 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE28740
Sequence length 701
Comment (Caenorhabditis remanei)
Sequence
MSKTGGNTEPMPFVRKWGNESDSGSADVSMGSMSHAAPPALVVPSLSAGGDTRKFLFQLF
PNTIMTASGSPSRTESVSERKRDKSRSRSRDRDRKKDRKKKDRSRSRDRDRDRRSRSRSP
RDRDRDRDRDSRRRRSSRSPRRRSRDRRSERRRDRSPPLMVPNSPQRVKEPVINPLIRED
LAAAVETGTVAVEAVQVGSIVPINPAKKERKSRWSTTKSFVPGMPTILPADLTEDQRNAY
LLQLEIEDATRKLRLADFGVPEGRERSPSPEPVYDANGKRLNTREVRKRQELEQLRHEKI
QALLKINPAFKPPADYRYCFKKKLYIRNNKYFSAPNIRLHDKVWIPQEQFPDLNFVGLLI
GPRGNTLKSLEAETGAKIIIRGKGSIKEGKLTNRLGPMPGENEPLHAYVTGTDMNVIKKA
CEKIKSVIAEATALPDNNELRKLQLRELALLNGTFRPEDLANGARCSNCGSDEHKSWECP
DAPNVTNQIKCINCGAFGHISKDCKNPKGMYASEAGMDDEYSALMAELGETPTGGSSSGG
HAASAGGGIPSLTGGDLGSRGGGMGRGRGGHRGGFQNPRELFGPPKGEEEQNPANAAMQG
YYDHYQQYAYANQYQQPYGAAAAASAYGQQQDYSDFYTSPGARGGTGAKANKGWYGSGSS
MPMPVPPPGSLGGFMPPPPPPPPMPGDLSSLLAAAPPPPPS
Download sequence
Identical sequences E3MK94
31234.CRE28740 CRE28740 XP_003103501.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]