SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE28897 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE28897
Domain Number 1 Region: 313-354
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000068
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 
Weak hits

Sequence:  31234.CRE28897
Domain Number - Region: 140-272
Classification Level Classification E-value
Superfamily Apolipophorin-III 0.000628
Family Apolipophorin-III 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE28897
Sequence length 410
Comment (Caenorhabditis remanei)
Sequence
MTEESRKGHGDSQGSNDVKEDENEATSTRLIDRFARNSRSRGGQRDFIEEWSHRNLLDGR
KDHSKIELYDDIFSQGRTSEGRIEGPKSRMSQDSILENEVVTDEDIESIVYDETTLLETE
PEITSESLIPIGESDVRASRREDDQSLKNSKDRNEMMAEAQKQEDVKEAVNAFMKSIDDR
IESSNSKSSKKLKEAKKKLEEAADQYKAGESSEAEAKFLRNIIRYQSAAQQVLTETIDEE
LEDQSKLIDEVMTTSEELAKKNEELMLKLKEMKTGEQEKDRPACFFCESTKHSAIVCYQF
RDYEERTNMLIADDKCLLCFRTGHQKKDCADSARYENCKRCKEEKHHVSICPKYATKERT
EMKQARGPSQKKEDEQGDMSGRHKEEWKELDGPKQSSSEAKKQRQPILPP
Download sequence
Identical sequences E3MXE2
XP_003099190.1.11157 CRE28897 31234.CRE28897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]