SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE29226 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE29226
Domain Number 1 Region: 283-327
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000068
Family Retrovirus zinc finger-like domains 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE29226
Sequence length 505
Comment (Caenorhabditis remanei)
Sequence
MVEEAQGMNVQISMDEVLKALADGRLKLTTKTTEGAGSGLVDSISRRIANFEYEPEEGQA
FEDWYLRYGDTITGEGTDLSDEAKRRLILSKLNQRDYNYFTNRILPDKTSEFKFEEIVNK
LKECFPSTRSTFARRMEFLKIIDKGGDLGEYTGRVKKAYADAKFNEMSSEQVQCLMWIKG
LRNNGTVDIRARAMQIMETRPTTTLIQLEHEIMKLLEFREDAKNIGGFRTSEEVFAVRKM
RTEKAKEQKRSSQRHLLRKEKQRENEGSSADENDSDEEKPTRNHNQRSKKCHRCGGEHNA
LNCWAKNKECFDCGRRGHISKKCREQQDDEKSDRSGHRVNYIVAKTPKRRRDIYKVNGIY
VKESKPRKISTEVVKNGSMKRHVRRWPDEKFEKIQKNREETGNKRCKSFVTRSPNPGRKE
KVGAFERHDRWEKKNPKENSRMQHELKVSFPETLGQHSQWNRGWKQQGSSTPSLPIPPQP
SFAMYPWRNNFGCSEIMCGFQIVTS
Download sequence
Identical sequences E3NJX1
XP_003091300.1.11157 CRE29226 31234.CRE29226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]