SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE29358 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE29358
Domain Number - Region: 299-326
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.022
Family Retrovirus zinc finger-like domains 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE29358
Sequence length 332
Comment (Caenorhabditis remanei)
Sequence
MVTQLMEAIQRIEKKVDKLQEEPEITAKLIERPAATSIHPLKEDEEGPVDRKEETTIQTE
ESIPSEEPDQMVSSGPSPQPPSEKRRRRSSSSSSSYSSRSSSASSSKRTSTRRSTSSKGH
ETGSHATKESNGHASRSESTKESNGHASRNESTKESSGQAPRSESTKEATRHAPPRDRTS
QPRAKETLKRRRISPPKTEESPRNRRRSPPQAKTSAQRRRITPPRTQNRPERHETERTSM
PVTHRFVLEKDMEEDSRNPCSFCSQRHFSDRCGNCVDMEERKRILTEKNRCWRCLLIRQP
GHNCPSRKCFYCAQYGHNKAICTRPETIVDDE
Download sequence
Identical sequences E3MY21
CRE29358 31234.CRE29358 XP_003098948.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]