SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE29784 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE29784
Domain Number 1 Region: 230-309
Classification Level Classification E-value
Superfamily RING/U-box 3.28e-16
Family U-box 0.078
Further Details:      
 
Domain Number 2 Region: 149-176
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000643
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE29784
Sequence length 1166
Comment (Caenorhabditis remanei)
Sequence
MSSIHYKFRAELDYKTLQFDGLHIRGEQLVREICAKENLKLELFELQLQNAHTKKMYTDD
ELIPRNSSIIVQRSPRKDAAKVQKVQAGVNSGMVNQADASSSSLDPNIHIGSAEFENMDE
AERLNHIRDQSTRAYDPSNFRRRPQGIMTGPPPPTYTCNRCYQPGHWYKNCPMLNTKRTT
GIPSQELMETTADDPAAMLHPSGKYVVPIMHWKARQDTLAKKLEDGSSSPAQADRKVPPE
LLCPLCQSLFKEAIVTSCCGNSYCAECIEQRIIDPENRKCPGADCGRDLSITSIIPNKTL
RDAAAAWLSAGAPGQPTAQGIQEPEQIRIRIGLKAPASSNAISSQQLTSGISPGSALVSQ
QPAPSVAVSTVPPSQVSTALAVSCLPSSSTLASTGIVQDVSLPPPRLHHELPPGIPGVTG
LPHFPQAVPGIPNAAVPQTQPVSLNYGFSIAAYTAGFPPAASSGPRVSTISDEWNAFLQT
KDRHDKRRDKDRPRHKDGHDSRSRRRRDSSSSSSSSSATSYSDEEERQRRRRREKESSKK
RRSVEKERPRRDDHRRERDRERDRDREYRDHRDHREHRDHRDARSSARSKDSKVSASSSS
HRRDRDDEKRRDRKRDDGRKKDREEKMEEDTRERANKDVESKDEDEIDGIIAEYGNALAP
ETVGETRVTEEKENLNDEEISTPHEENTQSPVSKAVDEDEPAADEEPVDEENSLPSREKS
LDSVNQAMETSEAEVAETKEEKMPLEEEEDDEEMEADVEMKENQEKEDEETDRKAKESQS
STMNTADEDDEGGKKSRKHKKSKKSKKHHRKEDDGDDEDEERRRKKHKKHKKEKKTKKDR
RDADSDQEDDRKHRKKERDSDKKYDDEDDSDRKERKKEKNRTESYSTTDRSERNKEKEKK
EDDVDDRKEKKKESDRRQDEDDKKKERKRDREHEEYDSDAPKIKVKRDEKIKDDRKESDR
EKDRKKEDEKEKRKERDERDKKREKEKEKEREKERAKEKEKEKEREREKEKERLKEKEKE
AEKERQKEKEREKNKEKERKEKAKELVPEKPRRSVHERLQRADTVKVSSSSSSKTVPTLA
RKPVSFTVTSSKAASNIRVRQYSSSSSTKEQEEEDVSRSKQDRRKKDETDVESIGDKDKK
QKSSRQLSASGPTVSMHKNTKIKFDL
Download sequence
Identical sequences E3LVS6
XP_003112172.1.11157 31234.CRE29784 CRE29784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]