SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE30202 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE30202
Domain Number - Region: 90-135
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0746
Family Voltage-gated potassium channels 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE30202
Sequence length 919
Comment (Caenorhabditis remanei)
Sequence
MNIISRIQKIYAERQARLKTLQIQSRQPDTASELSPSIPNQEPNTVEGSRTTGSTIVSRE
VPRTQTNLNSIRVIVSETSPETEFEPANKQRHFGILHYIVNNRFRKMMLIGFLNLLIFVI
FFASIFLFFYIQSGSEYKEEVSTKPFSTTTSPDVNGDTTTRTDTTAHSHSSDTTTNPFGE
FLSASKNIVLSDFLDRTDCSPNHKSTFFFAYSNDLTADQVLNTWKSISENPTFIFETYAL
TRFDMMDSSSTDSVSSFDSSHSISDITDALLSNLPNPADSFKDPSRGGTVLGIIDVFQSF
FCCDVTHCGATLFILTKRLPTETPSYVDYIVNTLKKYHAYATFVVSENSFGGLSPESMYR
VASETNGLCIFTEDDRIQETPTWVPSSWPSYLVYSFNAKVTNSGNVTLPIFNSPQVGNYY
ICMTLQDHGSLDTFRMVHLTWYNEGSSNSGSFEETVESHTDFGNTTYTNKGPYTLDAVPY
NLTLQYEFLGETTEVLQIRIYSVHIMSMPYRDFFENPLPEARESKNVLKKYWKAILFGLM
GFLIICLIAFLILFLVLLKPTDSITSSTVLPISGTTKNSNATTESFVTNEVSSTLTEGET
LSVTTPSPIVINVTSKPHPIPVLNVSTTIIPADYSTTFRSPTTNRLITVLTSAQSTVTEP
STPKPTSSALGSSYAMSTSGTTKHLTAPPAIVTVPEQSTTFGSTKVDLTTTTTLGDSTTS
KPLTTESIPTTPSTTPEYASSSTQETTLSSTTLSTSELTTPRSTKTATVSYHPESSTTLR
TIACKFRSANFCFTFQQISTILDPETSTISETSKGSTTVLKDLTTTKYLPTTETTPNQST
LFTTSLEYLSSSTQETTMSSTTKITTTEKISTSESTTSQSEKTTTVSEPYSTTVSSTETP
IHTSPSTMSITSRIPPQWR
Download sequence
Identical sequences E3NGK6
XP_003092464.1.11157 31234.CRE30202 CRE30202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]