SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE30341 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE30341
Domain Number 1 Region: 780-943
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.23e-51
Family Reverse transcriptase 0.00065
Further Details:      
 
Domain Number 2 Region: 489-520
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000068
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 
Weak hits

Sequence:  31234.CRE30341
Domain Number - Region: 547-646
Classification Level Classification E-value
Superfamily Acid proteases 0.000327
Family Retroviral protease (retropepsin) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE30341
Sequence length 947
Comment (Caenorhabditis remanei)
Sequence
MTANGSMELLSTDSTQNNSEAGNSASSRMSEVSLRERRKLVKGFTDFVEASGQMESDIFE
AVKMTCQGTARQLEGLIAPVKKYGKELRERFDELGGERWTLEIIGLMRENQVETVEELRE
LCERAALVRGGSGEQATPSSDDVKKLQEAWTKERDEVYEELDKLTKEKALADETVSKFKV
ALKEEREAHEKLKGVFQRQEGETRGGIQNDEIKEIQVRSPRQDAGKKSSIRNSEEDLLKT
GTEWELSEKSRSWCGDLRSAKAASCSAGNAAMQEMVSSMGRMMKASALPEPKTFDGTGDF
KEFRREFLLKYQQVTDEDDELVAILEERYLKGAAKSLFKSLEDRHERPIAELFVEFERKL
RKRQGDVKAEALHEFDRLQRAPGQKLWEYLVEVEKWSKKAYPEVEKATLSQMRTTKLMRA
TENDDLLQSVLVAKRLDLPLRDQYEHLKDIVLQRENEKMRKQKERAGAMKSQGNREGRRA
PGDRNSGDRKAVGEGKSTGAKLKCFTCGGVGHMSRQCVSKRVDKIQTHPGCSDKNVGAET
VEMVEMLGQRRRVIIDSGAVVSVMSTSAFEKLKSGCKNWEEEVEVLEEPTFTLLDASRSE
MQVKEQIKVPMVVRGRKVGVVFQLVENEREVLLIGTNAFESIGVELKWKAERAIARADEK
LRIPPQSCARVAVKVNADLGGEMLLESAKEWMPTCLCSKDEQGKLTAVVSNWRNEPLLIK
KNEILGMVSRDWDVWKEEKTKMVNMMELDKRVTLKGDARVEAVVKILEENGTMSGGMRGL
VAEFSDVFAIEENELTQTNMVDCAIELEKREPIRQKCRPVPLALQDKVRGMLKEMEARRV
IKKCRSPWASPVVLVKKKDGSIRMCVDYRKLNTVIKLNAHPLPHIESTLQALGNKKVFTT
LDLMAGYWQIPMEEESKEKTAFVVLNEQYQFEVMPFGLATSPEAMEQ
Download sequence
Identical sequences E3NVJ5
CRE30341 XP_003087576.1.11157 31234.CRE30341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]