SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE30774 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE30774
Domain Number 1 Region: 544-698
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.15e-41
Family Retroviral integrase, catalytic domain 0.0038
Further Details:      
 
Domain Number 2 Region: 352-442
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000713
Family Retroviral protease (retropepsin) 0.014
Further Details:      
 
Domain Number 3 Region: 280-324
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000379
Family Retrovirus zinc finger-like domains 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE30774
Sequence length 901
Comment (Caenorhabditis remanei)
Sequence
MSDADMNRKFIEMMELMQKQMAEQAKKHEETIAVLTKAVAENSQIDGPSGTSSGLTVSQS
QLMNDIGGRISVFQFDLETEKTFSKWYARYSTAFTEEGKGLDDKNRVALLVSKLSEEVYE
QYSRRICPKLHHEVNFKDTVDILKEMFDIKKSLFSHRFACINIARDGDSPVEYTNKVNAL
CELAMLKDIDPDGWKVFFWLRGLDPTQDTKARAYFLKYVEKKTELGEKVNINELCTEWQK
IQSQTSAVSEMEKSDTAVRAVYARRPSNQDQSREKNTSEDGNSEGGKCWNCGKRGHRKPD
CPKPLTTCFDCQKKGHMSSFCRSRKDSSSRKTQHVAIVGGASSEDAEVNSVRQYVSVEVN
SESVEFQLDTGSDITLIGREDWSRIGKPDLERCRSKVKSASGNELKILGRALVEFRLKGS
VGTGYVYVREHGNLLGLDWIGRSKEMSYHMGMMVDELTHSNTDAIHGGLNGKFPEVFKKG
LKRCVKKKAVLKVKENATPVSRSKRSSVQGASRVVEKVVSSCTISQGGKISRKIPLQPWK
APERVWQRVHIDYAGPENGQYYLVAVDAKSKWAEVMIVKSISAISTVRTLKDMFSQHGYP
ETLVSDNGTQFVSKEFATMCQDAGIEHVRSPAFHPQSNGQAERFVDTLKRGLEKLKGEGS
VNNEILSQFLLHYRSTPSNALGGLTPAEVHLGRRLRTRLSLMIPQLNKTVDSEQVAMKEQ
FDKHHGVKARSYRKGDSVFVKVFEKNTWSWKPGKVNQRQGRVVYVIGLNDGRERVVHANQ
MKMRLEESTQEQSNEHEWATTMFDVFELPTVWSARKSIDEARRDNATSTPVMDSPQRVHQ
GQGTSSSPAQQVQSRASTQPSSSQSTTTAVQGQRLAPSPVQPRRTTRVRKNVVKYDPSYH
S
Download sequence
Identical sequences E3LU80
CRE30774 31234.CRE30774 XP_003112417.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]