SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE30808 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE30808
Domain Number 1 Region: 831-932
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000169
Family Retroviral protease (retropepsin) 0.024
Further Details:      
 
Weak hits

Sequence:  31234.CRE30808
Domain Number - Region: 699-720
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000139
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE30808
Sequence length 1046
Comment (Caenorhabditis remanei)
Sequence
MMVTLAMFRVSDTTENAVLEVKGARGFCTVGPASFTGSPPRISSSDLPLQSGISYVALAI
SSENPFLHCGENQKQFWAFEASAVPSVTELQKIVQMRSTCNISDKRRSSAIFAVRRNQVG
DNTTCTGEKSATRKASDSSEVKAVEVRSQGPIRVYTLCVNDHTLIRGTSIVISSREAIHI
SRYSCENNHKLIRGTTVMFGGPGTAERCVVLCVNNHMLIGGTSIAFCSREAIPTVTDTFE
NDHMLIGGTSICFSVSEKTLMFKALTRNDLKTVGRSQFAKSSLEPISQLAAVIYSRLIAE
DETSASTDAEAKKNNVAAEQKRTYASTDTVESTKDTQVLSHNFSSVTGVIRKQKLALIVM
SVNGNDVKSSEPLTTSSKKKEEHPKFAKLELVNKQSQKTSKTSRSQHTTARSQVIKTNGK
KTGKKFTGRPVTRQQQVNSAKCRAEPTYQKAVKDNDTEMRISTSRQLCATRRHSQVTPAF
GFCTVGPAGVTGSPPQKNVSVVISNTLDKPAFFLTASATKLQKCPRILMISFASGPPLQS
FAGKIDEDFNVFERTFRDRITLTTMKPEMHLTCLLNYLIEDARDKAEEVIKKNEDASFQD
VIDALRHRFSSSHKVSAAKSQLRSTKRVAGEAVEVFYRRIIMKEELKEPEDILLRAMKIE
ADLNAESDVPVNITSQTNDSLPQVTAVHSKRVSERPLKNGRVKGTCHNCKSKGHYASDCW
RGVQVNRKHKSQSNHKTTPASTSSVTESSNDNEMIEKLKQQIKLKEEQLQFKDAQISKLK
KKQEGRTQKQVKFNDADHSVSIVHESGNTGQNISEIGQAPSTSHMCPYIASVPIRANGYA
TTALIDTGAQITVSSKHMCKVLGITQLDQPLSTHAAGFGLNSVEISGTAMVTYTIGSYKI
RHKTHFTVSRCTPDPFGGVEIIIGTDILSRMPPVQFDFRNARLQIGDDVILLGSKQPPQI
LFSIPCSPVSLTEAISSLQQFTDAVQKDRDNKSVQFKNRSKKQSRNRNSSPRSAGHQTQV
PGTTESSSHVRFQEVSDESQSSRPNQ
Download sequence
Identical sequences E3LUE1
CRE30808 XP_003112447.1.11157 31234.CRE30808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]