SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 314225.ELI_00230 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  314225.ELI_00230
Domain Number 1 Region: 423-520
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.69e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 314225.ELI_00230
Sequence length 533
Comment (Erythrobacter litoralis HTCC2594)
Sequence
MRRVVLHCNIAYLRPLILPVPLASDFPHRTAHRTGFMYSPAAFKRDWLSNVRADLLAGIV
VSLALIPEAIGFSIIAGVDPRVGLYASIAIAMIIAFTGGRPGMISAATAAVAVVVIPLVR
DYGVEYLFAATILMGIFQGIAAVLRLDLLMQFVGRAVITGFVNALAILIFMAQLPELTNV
GWETYAMVAVALAIIYLLPRVTTAVPSPLVAIVLLTLLTIWIDAPVNTVSDMGELPEGLP
YFVWPDVPLTWETLQIIAPYSATMAAVGLIESLLTARIVDDMTHTGSNKRRETWGQGVAN
IGAALVGGMGGCAMIGQSVINVTSGGRGRLSALTAGVTLLLLLWLLGPIVGQIPMPALVA
VMIMVSIGTFSWTSIPNLRHHPWQASVVMLATVAVVVTTHNLALGVLVGVLLSGIFFAAM
VMNLFEVTRTREGNTATYTARGQIFFASVERFEAALGPESKQPDPADHVIIDVSDAHFWD
ISGVGALDKVVERMRANGRSVQVVGLNEASADMVDRHAVTDRTGVELGLAPHP
Download sequence
Identical sequences Q2NDV3
gi|85372873|ref|YP_456935.1| 314225.ELI_00230 WP_011413016.1.18910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]