SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 314225.ELI_14580 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  314225.ELI_14580
Domain Number 1 Region: 87-144
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000157
Family NfeD domain-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 314225.ELI_14580
Sequence length 156
Comment (Erythrobacter litoralis HTCC2594)
Sequence
MFDGIEPYWVWVIIGLVLAALEILVPGVYLIWLAVAALLTGLLTFVFDPGLPLQIVNFVF
IALIAAFSAKRILRDRPIASADPLMNKRGGRLVGETAIVVQAFEGGTGRIHIGDGDWLAK
GVDLEIGERVRVTGHEGAILLVEPMNLIENTPRGES
Download sequence
Identical sequences Q2N5N3
WP_011415830.1.18910 314225.ELI_14580 gi|85375743|ref|YP_459805.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]