SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 314275.MADE_00758 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  314275.MADE_00758
Domain Number 1 Region: 12-138
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.12e-26
Family cAMP-binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 147-214
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000334
Family CAP C-terminal domain-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 314275.MADE_00758
Sequence length 223
Comment (Alteromonas macleodii Deep ecotype )
Sequence
MSYIHGIAQTVMPDDYLDNCMPYGNVKAYAASTTIHDRGSKNKGLSIVVSGEVKIGNYGL
DGSYQITTILRRGDTFGEFTLYASLARTHHAQALTECKILQIPEPAFHSLVSQHPAIAAF
ITRSLAIKLHAALERLDDIRRLPTHVQLAKLIYQAHLTSRRDFIPLRQSDYAERLGVTVL
TAHKSLTKLYDMQLLEKRYGGVVISNIERLEKFLKESSSLLPI
Download sequence
Identical sequences T2DM06
314275.MADE_00758 gi|543892425|ref|YP_008549995.1| WP_023559918.1.35093 WP_023559918.1.50651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]