SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 314275.MADE_01979 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  314275.MADE_01979
Domain Number - Region: 37-143
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000518
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 314275.MADE_01979
Sequence length 345
Comment (Alteromonas macleodii Deep ecotype )
Sequence
MEMLRINRENLRNSHETPWLILDLVMLGILFVNLTWLIFDALYATDFVYGLLGTYFPAFL
NAYDPIHANFLLVDLVFIAIFFTEFCFRWAVAIVRKEHLRWYFFPFLHWYDIIGLIPTGP
TRLFRFLRIFSILHRLHKFEIIDLNQTAVFRFFAFYYDVFVEELSDRIVVKVLSDAQKDI
SAGSPLLDDINAQVLAPRRPVITQWMAGVINHLGQSIQSEEHGEVIREHVRKSVGKAVRS
NAQVSSLHYLPVIGKTIENTLEESVTDIVTTSLVNLLSDLDAERIDHFISVGIHDYTPTA
DALDKEVLNVVNECLELVKAHVAQQRWKSHLTEKESAIPTGKPEI
Download sequence
Identical sequences 314275.MADE_01979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]