SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 314275.MADE_03944 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  314275.MADE_03944
Domain Number 1 Region: 21-249
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.11e-53
Family Voltage-gated potassium channels 0.00016
Further Details:      
 
Weak hits

Sequence:  314275.MADE_03944
Domain Number - Region: 252-303
Classification Level Classification E-value
Superfamily TerB-like 0.0259
Family COG3793-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 314275.MADE_03944
Sequence length 311
Comment (Alteromonas macleodii Deep ecotype )
Sequence
MAMSFRNACYHILAPASEAHEYKKRSQLFDVLLIALIIVNVAAMMLETVPGIPAVWQHEL
HIIEIVSVLIFTVEYLLRLYSSASAPNRPSREQTTPWQKRWAYIKSPMALVDLMAILPFY
LSVFVAFDLRILRVFRVLRILKIGRYSRSMQTLVTVLRNESHSLIAAISVLLLFTVIAAT
CIYYIEHTAQPDVFSSIPASLWWALVTLTTVGYGDAVPVTALGKVFGGLITILGICFYAL
PAGILSSSYTTQMQLKRDRFKDTVRSVLDDGKLSEHDVHHLEHVRALLDLDEEEAKLIVR
LLQHHHKGLDN
Download sequence
Identical sequences F2GBJ9
WP_012520115.1.35093 314275.MADE_03944 gi|332143335|ref|YP_004429073.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]