SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 314565.XC_0582 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  314565.XC_0582
Domain Number 1 Region: 13-110
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.89e-20
Family Anti-sigma factor antagonist SpoIIaa 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 314565.XC_0582
Sequence length 139
Comment (Xanthomonas campestris 8004)
Sequence
MTTLAIQIDPPQDTRQRVTLSGRLDTHTFHDLDEALSPLLATPITTLVLDLADLEYISSA
GIRSIFKARKALATRHGKVLVAHPQPQIRKVFDMVKAVPLSDVFASTEELDAYLSTMQRK
VIEEHANGDAPIVSHFANA
Download sequence
Identical sequences A0A0H2X3Y4 B0RN99 Q8P4T7
gi|188989994|ref|YP_001902004.1| gi|66766921|ref|YP_241683.1| 190485.XCC3619 314565.XC_0582 509169.xccb100_0599 NP_638965.1.47755 WP_011038703.1.10627 WP_011038703.1.12496 WP_011038703.1.15229 WP_011038703.1.16446 WP_011038703.1.1732 WP_011038703.1.18295 WP_011038703.1.18975 WP_011038703.1.22538 WP_011038703.1.27778 WP_011038703.1.31612 WP_011038703.1.36111 WP_011038703.1.36449 WP_011038703.1.40219 WP_011038703.1.40437 WP_011038703.1.43481 WP_011038703.1.4502 WP_011038703.1.475 WP_011038703.1.56666 WP_011038703.1.82601 WP_011038703.1.88278 WP_011038703.1.89271 gi|21233048|ref|NP_638965.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]