SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 314565.XC_1231 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  314565.XC_1231
Domain Number - Region: 101-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00248
Family NfeD domain-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 314565.XC_1231
Sequence length 144
Comment (Xanthomonas campestris 8004)
Sequence
MRWDVVAWAVLALLLIAAETLAPGAFLLWMGIAAAAVCVLVLAVPGTSVLLQIVAFVVLS
FVAIQVYRTWFRGKGRQSDRPLLNRRAEQLIGRSVLLDQAIVDGRGRAKVDDAFWVVSGP
DLPAGALVRIVAVDGMTLQVQPNT
Download sequence
Identical sequences A0A0H2X6W2 Q8P6T7
NP_638226.1.47755 WP_011038003.1.27778 WP_011038003.1.43481 gi|66767558|ref|YP_242320.1| gi|21232309|ref|NP_638226.1| 190485.XCC2878 314565.XC_1231 GO.2610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]