SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 314565.XC_3381 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  314565.XC_3381
Domain Number 1 Region: 82-182
Classification Level Classification E-value
Superfamily Fe-S cluster assembly (FSCA) domain-like 2.75e-26
Family PaaD-like 0.00043
Further Details:      
 
Weak hits

Sequence:  314565.XC_3381
Domain Number - Region: 27-59
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0589
Family NfeD domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 314565.XC_3381
Sequence length 184
Comment (Xanthomonas campestris 8004)
Sequence
MYSRSSEPVQFERDCDAVMVPQGDSVTLPAGSYGYITQALGGSYTVFVEGNLFRIAGKDG
DAIGKEAPPGLELPENASDEEVEALVWQQLRTCFDPEIPFNIVDLGLVYEAVVSHREEDN
QRRVDVKMTLTAPGCGMGEILVDDVRSKVEMIPTIAEADVELVFDPPWGRHMMSEAARLE
TGML
Download sequence
Identical sequences A0A0D0KND1 A0A0H2XAM2 A0A1C3NGD5 Q8PC85
190485.XCC0849 314565.XC_3381 gi|66769683|ref|YP_244445.1| NP_636240.1.47755 WP_011036085.1.10627 WP_011036085.1.10882 WP_011036085.1.12135 WP_011036085.1.12496 WP_011036085.1.15229 WP_011036085.1.16446 WP_011036085.1.1732 WP_011036085.1.18295 WP_011036085.1.18975 WP_011036085.1.1936 WP_011036085.1.22538 WP_011036085.1.25266 WP_011036085.1.27778 WP_011036085.1.31612 WP_011036085.1.36111 WP_011036085.1.36449 WP_011036085.1.40219 WP_011036085.1.40437 WP_011036085.1.43481 WP_011036085.1.4502 WP_011036085.1.475 WP_011036085.1.56666 WP_011036085.1.80866 WP_011036085.1.82601 WP_011036085.1.88278 WP_011036085.1.89271 gi|21230323|ref|NP_636240.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]