SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 314723.BH0337 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  314723.BH0337
Domain Number 1 Region: 140-429
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 8.16e-133
Family Enolase 0.00000000516
Further Details:      
 
Domain Number 2 Region: 5-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.61e-55
Family Enolase N-terminal domain-like 0.00000604
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 314723.BH0337
Sequence length 433
Comment (Borrelia hermsii DAH)
Sequence
MGFRIYEIKARQIIDSRGNPTVEADVILEDGSLGRAAVPSGASTGINEAVELRDGDKSVY
MGKGVLKAVENIINIISPELEGMSALNQVEIDRKMLALDGTPNKSKLGANAILAVSMATA
RAAAEYLGLKVYQYLGAYKANILPTPMCNIINGGAHSDNCVDFQEFMIMPIGAKTFNDAI
RMSAEVFHTLKGILSKRGYATSVGDEGGFAPNLKSNEEACEVIMEAIKNAGYTPGTDIAI
ALDPATSELYDPETKKYVLRWSTKEELTSEEMVEYWAKWVEKYPIISIEDGMAEEDWDGW
KKLTDKIGDKVQLVGDDLFVTNTSFLKKGIEMKVANAILIKVNQIGTLTETFEAVEMAKK
AGYTAIVSHRSGETEDTTIADLVVALGTGQIKTGSLSRTDRIAKYNQLLRIEEELGSIAE
YHGRDVFYSIKKQ
Download sequence
Identical sequences A0A142JBN7 B2S044
gi|187918207|ref|YP_001883770.1| WP_012422107.1.33311 WP_012422107.1.52594 WP_012422107.1.81499 WP_012422107.1.83851 314723.BH0337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]