SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 315730.BcerKBAB4_0901 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315730.BcerKBAB4_0901
Domain Number 1 Region: 6-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.06e-24
Family Anti-sigma factor antagonist SpoIIaa 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 315730.BcerKBAB4_0901
Sequence length 112
Comment (Bacillus weihenstephanensis KBAB4)
Sequence
MMNLAINILQNDLGYTVQLNGEIDAYTASDLKNKVMPIASEKEVYIVVDFNKVDYMDSTG
LGVFIALLKAIKKNDGKLEFIGVSRRLKRLFDITGLTEILNLNSDFEKVERR
Download sequence
Identical sequences A9VHF9 J8D1W2 R8HQ21
WP_002140676.1.17940 gi|163938898|ref|YP_001643782.1| 315730.BcerKBAB4_0901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]