SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 315730.BcerKBAB4_1923 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315730.BcerKBAB4_1923
Domain Number 1 Region: 79-139
Classification Level Classification E-value
Superfamily NfeD domain-like 4.45e-16
Family NfeD domain-like 0.0026
Further Details:      
 
Weak hits

Sequence:  315730.BcerKBAB4_1923
Domain Number - Region: 10-60
Classification Level Classification E-value
Superfamily Clc chloride channel 0.0249
Family Clc chloride channel 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 315730.BcerKBAB4_1923
Sequence length 142
Comment (Bacillus weihenstephanensis KBAB4)
Sequence
MAGWVIWFIIAGILFIAEMLSITFYMLWLGIGAVVGGLIALFAPDALFLQVVVGAIVSLT
LTFFTKRISKNFREAKGFTDTVDKLVGKKGIVMQAITSEVNGIVKVDGDTWTAISDTPID
AGEKVVVIQRHSTILQVKKESE
Download sequence
Identical sequences A0A109GEM3 A9VRW9
gi|163939898|ref|YP_001644782.1| WP_012260786.1.31050 WP_012260786.1.99908 315730.BcerKBAB4_1923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]