SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 315730.BcerKBAB4_3905 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315730.BcerKBAB4_3905
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.53e-31
Family Anti-sigma factor antagonist SpoIIaa 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 315730.BcerKBAB4_3905
Sequence length 116
Comment (Bacillus weihenstephanensis KBAB4)
Sequence
MSLSMHLEVKRDVLCVRLEGELDHHTAEELRTKVTDMIETHGVHHIILSLENLTFMDSSG
LGVILGRYKHVKGLGGEMVVCAISPPVKRLFEMSGLFKIVRLEESEAHALATLGVA
Download sequence
Identical sequences A0A084J3H3 A0A150C7R7 A0A1I5Y3W9 A0A243A452 A9VFH9 J8IM07 J8J0F5 J8KN08 J8NUL1 J8PAZ2 J9C9P2 R8D032 R8D4Z0 R8EN82 R8I3Y1 R8MNI2 W4DRV1
315730.BcerKBAB4_3905 gi|163941817|ref|YP_001646701.1| WP_002128957.1.10033 WP_002128957.1.100646 WP_002128957.1.100649 WP_002128957.1.11324 WP_002128957.1.17940 WP_002128957.1.20051 WP_002128957.1.20881 WP_002128957.1.21695 WP_002128957.1.27729 WP_002128957.1.27732 WP_002128957.1.28299 WP_002128957.1.2902 WP_002128957.1.2904 WP_002128957.1.30061 WP_002128957.1.31050 WP_002128957.1.35095 WP_002128957.1.36226 WP_002128957.1.37635 WP_002128957.1.37801 WP_002128957.1.38645 WP_002128957.1.39255 WP_002128957.1.39317 WP_002128957.1.39896 WP_002128957.1.4354 WP_002128957.1.4496 WP_002128957.1.45835 WP_002128957.1.46157 WP_002128957.1.47674 WP_002128957.1.47957 WP_002128957.1.50411 WP_002128957.1.54007 WP_002128957.1.57105 WP_002128957.1.59016 WP_002128957.1.60236 WP_002128957.1.63476 WP_002128957.1.6426 WP_002128957.1.64566 WP_002128957.1.68186 WP_002128957.1.68668 WP_002128957.1.72867 WP_002128957.1.75292 WP_002128957.1.76817 WP_002128957.1.79293 WP_002128957.1.82832 WP_002128957.1.8290 WP_002128957.1.85187 WP_002128957.1.86789 WP_002128957.1.87416 WP_002128957.1.93582 WP_002128957.1.99558 WP_002128957.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]