SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 315730.BcerKBAB4_4718 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315730.BcerKBAB4_4718
Domain Number 1 Region: 13-136
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.83e-24
Family Voltage-gated potassium channels 0.0007
Further Details:      
 
Domain Number 2 Region: 115-251
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.36e-16
Family Potassium channel NAD-binding domain 0.0048
Further Details:      
 
Weak hits

Sequence:  315730.BcerKBAB4_4718
Domain Number - Region: 296-329
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.000118
Family TrkA C-terminal domain-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 315730.BcerKBAB4_4718
Sequence length 331
Comment (Bacillus weihenstephanensis KBAB4)
Sequence
MKSRPNLVDTFRDSIIFRLICFIIVLTAFSGFLIHILEPSHFTTWFDGVWWSIVTIFTVG
YGDFAPHTTIGKLIGICIILLGTGLCSYYMVLFATDMINKQYMRIKGEAAATSNGHMIIV
GWNERAKHVVKQMHILQPNLDIVLIDETLSLLPKPFHHLEFIKGCPHHDQTLLKANITTA
HTILITADKEKNESLADTQSILNILTAKGLNPNIHCIAELLTSEQIQNATRAGVSEIIEG
NKLTSYVFTASLLFPSISGVLFSLYDEISDNKLQLMEIPPSCTGQSFANCSYTLLKQNIL
LLGVKRDEQYMINPVHSFILIESDILIVIHH
Download sequence
Identical sequences A0A1S9TIK0 A0A1S9XUU9 A9VMW3
315730.BcerKBAB4_4718 WP_012261908.1.11324 WP_012261908.1.39896 WP_012261908.1.93582 WP_012261908.1.99908 gi|163942612|ref|YP_001647496.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]