SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 315750.BPUM_0151 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315750.BPUM_0151
Domain Number 1 Region: 396-476
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000294
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 315750.BPUM_0151
Sequence length 480
Comment (Bacillus pumilus SAFR-032)
Sequence
MKDLFVKQEWFGYVRQDVLAGILVALALIPEAIAFSIIAGVDPKVGLYASFCIAIVISFV
GGRPGMISAATGAMALVMVNLVADHGLQYLFAATILTGLIQIVFGLCRVSRLMKFIPRSV
MVGFVNALAIMIFMAQLPHFVGESLAMYIMTGGALLIIYLLPMVVKVIPSPLIAIIVMTI
IAVFGHIDVRTVGDMGELPSTLPAFLIPQVPFSWETLAIIFPYSLALAMVGLLESLLTAQ
IVDDMTETSSRKNKEARGQGIANVVAGFFGGMAGCAMIGQSVINTKAGGRGRLSTFVAGA
FLMVLIFVLGDVVVQIPMAALVAVMIMVSVGTFDWSSFQQLKKNPKTDSIVMIVTVVTVV
LTHDLSKGVFAGVLLSAVFFVAKISKLHITSTEKQVGTWVYRIKGQIFFASVTDFIQAFH
QGNDLQTVVIDLSEARIWDESGVAAIERVKEKYHAAGVQVDIVGMDTQSRNLVKQVNGSS
Download sequence
Identical sequences A8F9D3
WP_012008730.1.28396 gi|157690948|ref|YP_001485410.1| 315750.BPUM_0151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]