SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 315750.BPUM_1683 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315750.BPUM_1683
Domain Number 1 Region: 166-275
Classification Level Classification E-value
Superfamily SpoIIaa-like 9.22e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0074
Further Details:      
 
Weak hits

Sequence:  315750.BPUM_1683
Domain Number - Region: 13-141
Classification Level Classification E-value
Superfamily An anticodon-binding domain of class I aminoacyl-tRNA synthetases 0.0654
Family C-terminal domain of class I lysyl-tRNA synthetase 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 315750.BPUM_1683
Sequence length 282
Comment (Bacillus pumilus SAFR-032)
Sequence
MDKNRALYDYFMQHAEKLTETWYDSIEDDDPESIYRSTDSSIISELKRQNQDYYQHFIRA
LIEDKTYLHTEFKKWSEDLASDPKHLNTPLDYVVREYMSNQRVVLHYLKEFIKQRQDDID
IDRIFYWYDLISEAFNISIHVFIQQYVKNTTKKLVAQRDMIYELSSPVIVLKSHIALLPL
VGDIDTARAKIILENTLKQCSQKGVQHLCIDLSGVVIIDTMVAQQIFDLVTSLRLIGVET
TISGIRPEIAQTAVQLGLPFNEFRTAASLAHALERMTEFSPI
Download sequence
Identical sequences A8FDP4
gi|157692459|ref|YP_001486921.1| WP_012010093.1.28396 315750.BPUM_1683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]