SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 315750.BPUM_2078 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315750.BPUM_2078
Domain Number 1 Region: 3-113
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.55e-31
Family Anti-sigma factor antagonist SpoIIaa 0.0000051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 315750.BPUM_2078
Sequence length 117
Comment (Bacillus pumilus SAFR-032)
Sequence
MSLDIDFQVKESVLCIRLTGELDHHSAETLRQKVTNYLETEDIRHIVLNLADLTFMDSSG
LGVILGRYKEIKQLGGEMVVCAISPAVNRLFDMSGLFKIIRMEPSEQTALQTLGVAS
Download sequence
Identical sequences A0A200HGS3 A8FET1
WP_012010448.1.28396 WP_012010448.1.38286 WP_012010448.1.71105 315750.BPUM_2078 gi|157692846|ref|YP_001487308.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]