SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 315750.BPUM_2272 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315750.BPUM_2272
Domain Number 1 Region: 14-192
Classification Level Classification E-value
Superfamily ClpP/crotonase 6.47e-28
Family Clp protease, ClpP subunit 0.013
Further Details:      
 
Weak hits

Sequence:  315750.BPUM_2272
Domain Number - Region: 376-437
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00288
Family NfeD domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 315750.BPUM_2272
Sequence length 437
Comment (Bacillus pumilus SAFR-032)
Sequence
MKKIKISIALFSCFIICLLLGVQLTAKSVDQKVHVIPIEDTVEKGLSKFIERSFEHAKSE
RAKHIILDINTPGGAVDAALEIADTIRASDIPVTAFVNHRALSAGAFLALNADQIYMTPN
GKMGAAAIIDGEGNAADQKSESLWLAEMSDAAEKQGRDPKYALAMADPDIDAKDAGAPKG
ELLTFNTDRALQFGYAEGEAKNLDDLLQKLKLANASVQYDEVSFAEKVARFLTHPIVIPI
LLSIASLGLIVELYSPGFGVPGTMGVTALLLFFYGHLVAGFAGYETLFLFLAGLLLLILE
LFLPGGIVGVIGLICVVVSLFLAAGSFTEMAISILIATAVSIIAVILLTKVLGKRMKFFK
KFILTDSTNKESGYVSNETREDLVGQIAVTLTALRPSGTAVLGDERIDVVSEGAFIDKDE
QVKIVKAEGSRIVVRKV
Download sequence
Identical sequences A0A200HLH3 A8FFC4
gi|157693039|ref|YP_001487501.1| WP_012010622.1.28396 WP_012010622.1.38286 315750.BPUM_2272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]