SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316055.RPE_0602 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316055.RPE_0602
Domain Number 1 Region: 204-457
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.2e-60
Family Pyruvate oxidase and decarboxylase Pyr module 0.041
Further Details:      
 
Domain Number 2 Region: 10-224
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.89e-22
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.014
Further Details:      
 
Domain Number 3 Region: 470-572
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6.71e-20
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316055.RPE_0602
Sequence length 577
Comment (Rhodopseudomonas palustris BisA53)
Sequence
MTMPLHAKSLSIALTGSGGAGVMTAGQILLDAAASCGLYGLMTRSTGPQIRGGEAAAIIR
LATEQLQSPGDRIDVLLALDFDNVDRFAAELPLDRDSLIIADLAAGEAPAFLKNSGAPIE
FVPLTKLAKAIEGGRVAMIGLGILAKLIGIPETAIVAAIAAAIGQRKPEAIESSRKAVEV
GVGIAPDSTLPRLALPAEPHARPRWSITGNEAAGLGALRGGVKFVGGYPITPATEILEWM
AGALPQCGGILMQAEDELASINMIIGASYGGVPALTATAGPGLSLMIESLGLAVASEIPL
VVVNVMRSGPSTGIATKSEQSDLNIAVYGLHGDAPHVVTAPLSISDCLLTAQWSVHLAET
LQTPVIMLSDQSLGQTRAVIDRPDDVDFPSKRLVAEANAENYQRYADTASGVSPMAIPGT
PGCQYTADGLTHTQRGTPSSQARDHVGQMDKRQRKFDAFDFGAHWAEIDGDGELAVVTWG
SSSGPLREAVDAARAAGIGVKLIALRLISPAQPARLAAALQGVKRVLVVEQNHTGQFWRY
LRAHYDLPDDVVPIHCPGPLPIRPGQALAHIQKGVAA
Download sequence
Identical sequences Q07U24
316055.RPE_0602 gi|115522629|ref|YP_779540.1| WP_011662054.1.72802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]