SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316055.RPE_4068 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316055.RPE_4068
Domain Number 1 Region: 9-146
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.89e-32
Family cAMP-binding domain 0.0079
Further Details:      
 
Domain Number 2 Region: 150-226
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.5e-20
Family CAP C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 316055.RPE_4068
Sequence length 240
Comment (Rhodopseudomonas palustris BisA53)
Sequence
MATVDPSLVAHLPMFSGLNAQDLDAVLHDARSARFAKNSAVFQQGEDAHSFFLLLHGHVR
ASKTTPTGEQVVVRYVSPGETFGVATAIGLSRYPATATAVDDSVVLVWPAGAWPRLVERY
PALSANTLRVVGSRLQETHTRVIEMSTQQVEQRVARALLRLAKQSGRKVEQGVEIAFPIS
RQDIAQMTGTTLHTVSRLLSGWEQRGLIESGRQRIVLRDAHALVVLAEAGSRDSEASNKS
Download sequence
Identical sequences Q07J90
gi|115526063|ref|YP_782974.1| WP_011665454.1.72802 316055.RPE_4068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]